0
Inquiry Basket
Quote

Peginterferon beta-1a

Cat# : THP-0023

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0023 Peginterferon beta-1a June 16, 2024 1 vial $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0023
Product Name:  Peginterferon beta-1a
Description:  The product is an interferon beta-1a to which a single, linear 20,000 dalton (Da) methoxy poly(ethyleneglycol)-O-2-methylpropionaldehyde (PEG) molecule is covalently attached to the alpha amino group of the N-terminal amino acid residue. The amino acid sequence of the recombinant interferon beta-1a is identical to that of the human interferon beta counterpart.
Sequences:  MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Species:  Human
Molecular Weight:  22500.0 Da (predicted)
Cas No:  1211327-92-2
Formula:  Not Available
Endotoxin Level:  <0.001 EU per 1 μg by the LAL method
Biological Activity:  125ug/0.5ml
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.