Peginterferon beta-1a

Specification

• Cat#: THP-0023
• Product Name: Peginterferon beta-1a
• Cas No: 1211327-92-2
• Description: The product is an interferon beta-1a to which a single, linear 20,000 dalton (Da) methoxy poly(ethyleneglycol)-O-2-methylpropionaldehyde (PEG) molecule is covalently attached to the alpha amino group of the N-terminal amino acid residue. The amino acid sequence of the recombinant interferon beta-1a is identical to that of the human interferon beta counterpart.
• Sequences: MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
• Species: Human
• Molecular Weight: 22500.0 Da (predicted)
• Formula: Not Available
• Endotoxin: <0.001 EU per 1 μg by the LAL method
• Application: For the treatment of patients with relapsing forms of multiple sclerosis.
• Concentration: 125ug/0.5ml

Pharmaceutical Information

• Pharmaceutical Application: Peginterferon beta-1a