Lipegfilgrastim, Pegylated GCSF

Specification

• Cat#: THP-0083
• Product Name: Lipegfilgrastim, Pegylated GCSF
• Cas No: 1117844-87-7
• Description: The product is a pegylated, recombinant granulocyte colony-stimulating factor (G-CSF) that was synthetized using a highly site-specific glycoPEGylation technology. The product is a covalent conjugate of Filgrastim with a single methoxy polyethylene glycol (PEG) molecule via a carbohydrate linker consisting of glycine, N-acetylneuraminic acid and N-acetylgalactosamine. The average molecular mass of the product comprises 18,798 Da for Filgrastim, 203 Da for GalNAc, 338 Da for glycylsialic acid and approximately 20,000 Da for PEG.
• Sequences: MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
• Species: Human
• Molecular Weight: 39000.0 Da (glycoPEGylated, approximate)
• Purity: >99% by SDS-Page and HPLC analysis
• Formula: C866H1372N226O258S9*(C2H4O)n
• Endotoxin: <0.001 EU per 1 μg by the LAL method
• Application: Indicated for the reduction in the duration of neutropenia and the incidence of febrile neutropenia in adult patients treated with cytotoxic chemotherapy for malignancy (with the exception of chronic myeloid leukaemia and myelodysplastic syndromes).

Pharmaceutical Information

• Pharmaceutical Application: Pegylated GCSF
• Targets: Target 1. Granulocyte colony-stimulating factor receptor