0
Inquiry Basket
Quote

Leridistim

Cat# : THP-0301

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0301 Leridistim July 20, 2024 1 vial $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0301
Product Name:  Leridistim
Description:  Leridistim, a recombinant chimeric dual G-CSF and IL-3 receptor agonist, binds with high affinity to both the interleukin-3 (IL-3) and granulocyte colony-stimulating factor (G-CSF) receptors, thereby stimulating the production and maturation of neutrophils, platelets, and lymphocytes after chemotherapy.
Sequences:  ANCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMDNNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQYVEGGGGSPGEPSGPISTINPSPPSKESHKSPNMATPLGPASSLPQSFLLKSLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Species:  Human
Molecular Weight:  34.828 kDa
Cas No:  193700-51-5
Formula:  C1550H2463N425O462S12
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.