Interferon alfa-n1

Specification Drug Information Related Products

Cat#:	THP-0179
Product Name:	Interferon alfa-n1
Description:	Native purified glycosylated human alpha interferon subtypes.
Sequences:	CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Species:	Human
Molecular Weight:	19241.1 Da
Cas No:	74899-72-2
Formula:	C860H1353N227O255S9
Endotoxin Level:	<0.001 EU per 1 μg of the peptide by the LAL method
Biological Activity:	10000000 unit / mL

Drug Name:	Interferon alfa-n1
Applications:	For treatment of venereal or genital warts caused by the Human Papiloma Virus
Examples of Clinical Use:	Venereal or genital warts
Pharmacodynamics:	Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. The product also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of action:	Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
Affected organisms:	Humans and other mammals
Targets:	Target 1. Interferon alpha/beta receptor 2; Target 2. Interferon alpha/beta receptor 1