Insulin Pork(Native purified)

Specification

• Cat#: THP-0131
• Product Name: Insulin Pork(Native purified)
• Description: This product is Insulin purified from pig pancreas, composed of alpha and beta chains, processed from pro-insulin, and also forms a hexameric structure.
• Sequences: GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT
• Species: Pig
• Molecular Weight: 5795.6 Da
• Source: Pig Pancreas
• Cas No: 12584-58-6
• Formula: C257H387N65O76S6
• Endotoxin Level: <0.001 EU per 1 μg of the protein by the LAL method
• Biological Activity: 100IU/ml

Pharmaceutical Information

• Pharmaceutical Application: Insulin Pork
• Applications: For the treatment of type I and II diabetes mellitus.
• Examples of Clinical Use: Type 1 or 2 diabetes mellitus
• Pharmacodynamics: Insulin is used in the treatment of type I and type II diabetes. The primary activity of insulin is the regulation of glucose metabolism. In muscle and other tissues (except the brain), insulin causes rapid transport of glucose and amino acids intracellularly. It also promotes anabolism, and inhibits protein catabolism. In the liver, insulin promotes the uptake and storage of glucose in the form of glycogen, inhibits gluconeogenesis, and promotes the conversion of excess glucose into fat.
• Mechanism of action: Insulin binds to the insulin receptor (IR), a heterotetrameric protein consisting of two extracellular alpha units and two transmembrane beta units. The binding of insulin to the alpha subunit of IR stimulates the tyrosine kinase activity intrinsic to the beta subunit of the receptor. The bound receptor is able to autophosphorylate and phosphorylate numerous intracellular substrates such as insulin receptor substrates (IRS) proteins, Cbl, APS, Shc and Gab 1. These activated proteins, in turn, lead to the activation of downstream signaling molecules including PI3 kinase and Akt. Akt regulates the activity of glucose transporter 4 (GLUT4) and protein kinase C (PKC) which play a critical role in metabolism.
• Affected organisms: Humans and other mammals
• Targets: Target 1. Insulin receptor; Target 2. Insulin-like growth factor 1 receptor; Target 3. Insulin-degrading enzyme; Target 4. HLA class II histocompatibility antigen, DQ alpha 2 chain; Target 5. HLA class II histocompatibility antigen, DQ beta 1 chain; Target 6. Retinoblastoma-associated protein; Target 7. Cathepsin D; Target 8. Carboxypeptidase E; Target 9. Neuroendocrine convertase 2; Target 10. Neuroendocrine convertase 1; Target 11. Protein NOV homolog; Target 12. Low-density lipoprotein receptor-related protein 2; Target 13. Insulin-like growth factor-binding protein 7; Target 14. Synaptotagmin-like protein 4; Enzyme 1. Cytochrome P450 1A2