Insulin Pork(Native purified)

Specification

• Cat#: THP-0131
• Product Name: Insulin Pork(Native purified)
• Cas No: 12584-58-6
• Description: This product is Insulin purified from pig pancreas, composed of alpha and beta chains, processed from pro-insulin, and also forms a hexameric structure.
• Sequences: GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT
• Species: Pig
• Molecular Weight: 5795.6 Da
• Source: Pig Pancreas
• Formula: C257H387N65O76S6
• Endotoxin: <0.001 EU per 1 μg of the protein by the LAL method
• Biological Activity: 100IU/ml
• Application: For the treatment of type I and II diabetes mellitus.

Pharmaceutical Information

• Pharmaceutical Application: Insulin Pork
• Targets: Target 1. Insulin receptor; Target 2. Insulin-like growth factor 1 receptor; Target 3. Insulin-degrading enzyme; Target 4. HLA class II histocompatibility antigen, DQ alpha 2 chain; Target 5. HLA class II histocompatibility antigen, DQ beta 1 chain; Target 6. Retinoblastoma-associated protein; Target 7. Cathepsin D; Target 8. Carboxypeptidase E; Target 9. Neuroendocrine convertase 2; Target 10. Neuroendocrine convertase 1; Target 11. Protein NOV homolog; Target 12. Low-density lipoprotein receptor-related protein 2; Target 13. Insulin-like growth factor-binding protein 7; Target 14. Synaptotagmin-like protein 4; Enzyme 1. Cytochrome P450 1A2