0
Inquiry Basket
Quote

Insulin Pork(Native purified)

Cat# : THP-0131

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0131 Insulin Pork(Native purified) March 01, 2024 1 vial $3,998.00
Add to Car Online Order Request a Bulk Order
Cat#:  THP-0131
Product Name:  Insulin Pork(Native purified)
Description:  This product is Insulin purified from pig pancreas, composed of alpha and beta chains, processed from pro-insulin, and also forms a hexameric structure.
Sequences:  GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT
Species:  Pig
Molecular Weight:  5795.6 Da
Source:  Pig Pancreas
Cas No:  12584-58-6
Formula:  C257H387N65O76S6
Endotoxin Level:  <0.001 EU per 1 μg of the protein by the LAL method
Biological Activity:  100IU/ml
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.