0
Inquiry Basket
Check Out

Human chorionic gonadotropin (HCG)

Cat# : THP-0140

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0140 Human chorionic gonadotropin (HCG) September 28, 2023 1 vial $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0140
Product Name:  Human chorionic gonadotropin (HCG)
Description:  Human chorionic gonadotropin (HCG), a polypeptide hormone purified from human placenta. HCG is composed of an alpha and a beta sub-unit. The alpha sub-unit is essentially identical to the alpha sub­ units of the human pituitary gonadotropins, luteinizing hormone (LH) and follicle-stimulating hormone (FSH), as well as to the alpha sub-unit of human thyroid-stimulating hormone (TSH), while the beta sub­ units of these hormones differ in amino acid sequence.
Sequences:  APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSSKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
Species:  Human
Molecular Weight:  Not Available
Source:  Human Placenta
Cas No:  9002-61-3
Formula:  Not Available
Endotoxin Level:  <0.001 EU per 1 μg by the LAL method
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2023 Creative BioMart. All Rights Reserved.