0
Inquiry Basket
Quote

Human chorionic gonadotropin (HCG)

Cat# : THP-0140

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0140 Human chorionic gonadotropin (HCG) November 05, 2025 5000IU $1,598.00
20000IU $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0140
Product Name:  Human chorionic gonadotropin (HCG)
Cas No:  9002-61-3
Description:  Human chorionic gonadotropin (HCG), a polypeptide hormone purified from human placenta. HCG is composed of an alpha and a beta sub-unit. The alpha sub-unit is essentially identical to the alpha sub­ units of the human pituitary gonadotropins, luteinizing hormone (LH) and follicle-stimulating hormone (FSH), as well as to the alpha sub-unit of human thyroid-stimulating hormone (TSH), while the beta sub­ units of these hormones differ in amino acid sequence.
Sequences:  APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSSKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
Species:  Human
Molecular Weight:  Not Available
Source:  Human Placenta
Formula:  Not Available
Endotoxin:  <0.001 EU per 1 μg by the LAL method
Application:  For the treatment of prepubertal cryptorchidism (not due to anatomical obstruction), for the treatment of selected cases of hypogonadotropic hypogonadism (hypogonadism secondary to a pituitary deficiency) in males and for the induction of ovulation and pregnancy in the anovulatory, infertile woman in whom the cause of anovulation is secondary and not due to primary ovarian failure, and who has been appropriately pretreated with human menotropins.
Not For Human Consumption!

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2025 Creative BioMart. All Rights Reserved.