Cat# : THP-0140
Catalog# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
THP-0140 | Human chorionic gonadotropin (HCG) | February 22, 2025 | 5000IU | $1,598.00 |
|
20000IU | $3,998.00 |
|
|||
Add to Cart Online Order Request a Bulk Order |
Cat#: | THP-0140 |
Product Name: | Human chorionic gonadotropin (HCG) |
Cas No: | 9002-61-3 |
Description: | Human chorionic gonadotropin (HCG), a polypeptide hormone purified from human placenta. HCG is composed of an alpha and a beta sub-unit. The alpha sub-unit is essentially identical to the alpha sub units of the human pituitary gonadotropins, luteinizing hormone (LH) and follicle-stimulating hormone (FSH), as well as to the alpha sub-unit of human thyroid-stimulating hormone (TSH), while the beta sub units of these hormones differ in amino acid sequence. |
Sequences: | APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSSKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ |
Species: | Human |
Molecular Weight: | Not Available |
Source: | Human Placenta |
Formula: | Not Available |
Endotoxin: | <0.001 EU per 1 μg by the LAL method |
Application: | For the treatment of prepubertal cryptorchidism (not due to anatomical obstruction), for the treatment of selected cases of hypogonadotropic hypogonadism (hypogonadism secondary to a pituitary deficiency) in males and for the induction of ovulation and pregnancy in the anovulatory, infertile woman in whom the cause of anovulation is secondary and not due to primary ovarian failure, and who has been appropriately pretreated with human menotropins. |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2025 Creative BioMart. All Rights Reserved.