0
Inquiry Basket
Quote

Glucarpidase, Recombinant Carboxypeptidase G2

Cat# : THP-0121

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0121 Glucarpidase, Recombinant Carboxypeptidase G2 April 20, 2024 1 vial $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0121
Product Name:  Glucarpidase, Recombinant Carboxypeptidase G2
Description:  The product is recombinant Pseudomonas sp. (strain RS-16) enzyme carboxypeptidase G2 expressed in E.coli.
Sequences:  ALAQKRDNVLFQAATDEQPAVIKTLEKLVNIETGTGDAEGIAAAGNFLEAELKNLGFTVTRSKSAGLVVGDNIVGKIKGRGGKNLLLMSHMDTVYLKGILAKAPFRVEGDKAYGPGIADDKGGNAVILHTLKLLKEYGVRDYGTITVLFNTDEEKGSFGSRDLIQEEAKLADYVLSFEPTSAGDEKLSLGTSGIAYVQVNITGKASHAGAAPELGVNALVEASDLVLRTMNIDDKAKNLRFNWTIAKAGNVSNIIPASATLNADVRYARNEDFDAAMKTLEERAQQKKLPEADVKVIVTRGRPAFNAGEGGKKLVDKAVAYYKEAGGTLGVEERTGGGTDAAYAALSGKPVIESLGLPGFGYHSDKAEYVDISAIPRRLYMAARLIMDLGAGK
Species:  Pseudomonas sp.
Molecular Weight:  44016.6653 Da
Source:  E. coli
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  9074-87-7
Formula:  C1950H3157N543O599S7
Endotoxin Level:  <0.001 EU per 1 μg of the protein by the LAL method
Biological Activity:  1000U
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.