Name: Glucarpidase, Recombinant Carboxypeptidase G2
SKU: THP-0121
Price: 3998 USD

Specification

Pharmaceutical Information

Cat#:	THP-0121
Product Name:	Glucarpidase, Recombinant Carboxypeptidase G2
Cas No:	9074-87-7
Description:	The product is recombinant Pseudomonas sp. (strain RS-16) enzyme carboxypeptidase G2 expressed in E.coli.
Sequences:	ALAQKRDNVLFQAATDEQPAVIKTLEKLVNIETGTGDAEGIAAAGNFLEAELKNLGFTVTRSKSAGLVVGDNIVGKIKGRGGKNLLLMSHMDTVYLKGILAKAPFRVEGDKAYGPGIADDKGGNAVILHTLKLLKEYGVRDYGTITVLFNTDEEKGSFGSRDLIQEEAKLADYVLSFEPTSAGDEKLSLGTSGIAYVQVNITGKASHAGAAPELGVNALVEASDLVLRTMNIDDKAKNLRFNWTIAKAGNVSNIIPASATLNADVRYARNEDFDAAMKTLEERAQQKKLPEADVKVIVTRGRPAFNAGEGGKKLVDKAVAYYKEAGGTLGVEERTGGGTDAAYAALSGKPVIESLGLPGFGYHSDKAEYVDISAIPRRLYMAARLIMDLGAGK
Species:	Pseudomonas sp.
Molecular Weight:	44016.6653 Da
Source:	E. coli
Purity:	>99% by SDS-Page and HPLC analysis
Formula:	C1950H3157N543O599S7
Endotoxin:	<0.001 EU per 1 μg of the protein by the LAL method
Biological Activity:	1000U
Application:	Used in patients on methotrexate treatment who have kidney dysfunction, and are experiencing an abnormally high plasma concentration of methotrexate (> 1 micromole per liter).

Pharmaceutical Application:	Glucarpidase
Targets:	Target 1. Methotrexate

Catalog#	Product Name	Size	Price	Inquiry
THP-0356	Exbivirumab			Inquiry
THP-0357	Libivirumab			Inquiry
THP-0400	Firivumab			Inquiry
THP-0401	Gedivumab			Inquiry
THP-0399	Diridavumab			Inquiry
THP-0351	Recombinant Human IGF1 and IGFBP3 Protein			Inquiry
THP-0398	Luspatercept	10ug	$498.00	Add to Cart Order
THA-0007	Cetuximab, Recombinant Anti-Human EGFR Monoclonal Antibody	1mg	$598.00	Add to Cart Order
THP-1108	Recombinant stabilized RSV B prefusion F antigen	20ug(10ug RSV preF A and 10ug RSV preF B)	$698.00	Add to Cart Order
		40ug(20ug RSV preF A and 20ug RSV preF B)	$998.00	Add to Cart Order
		120ug(60ug RSV preF A and 60ug RSV preF B)	$1,998.00	Add to Cart Order
THP-1105	Motixafortide			Inquiry