0
Inquiry Basket
Quote

Depelestat

Cat# : THP-0296

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0296 Depelestat June 16, 2024 1 vial $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0296
Product Name:  Depelestat
Description:  Engineered protein inhibitor of human neutrophil elastase
Sequences:  EACNLPIVRGPCIAFFPRWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVP
Species:  Human
Molecular Weight:  6.231 kDa
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  506433-25-6
Formula:  C282H412N74O75S6
Endotoxin Level:  <0.001 EU per 1 μg of the peptide by the LAL method
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.