0
Inquiry Basket
Quote

Darbepoetin alfa, Human EPO

Cat# : THP-0064

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0064 Darbepoetin alfa, Human EPO March 01, 2024 1 vial $3,998.00
Add to Car Online Order Request a Bulk Order
Cat#:  THP-0064
Product Name:  Darbepoetin alfa, Human EPO
Description:  Human erythropoietin with 2 aa substitutions to enhance glycosylation (5 N-linked chains), 165 residues (MW=37 kD). Produced in Chinese hamster ovary (CHO) cells by recombinant DNA technology.
Sequences:  APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Species:  Human
Molecular Weight:  18396.1 Da
Source:  CHO
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  209810-58-2
Formula:  C815H1317N233O241S5
Endotoxin Level:  <0.001 EU per 1 μg of the protein by the LAL method
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.