Corticotropin, ACTH

Specification

• Cat#: THP-0031
• Product Name: Corticotropin, ACTH
• Description: The product (ACTH or adrenocorticotropic hormone) is a polypeptide hormone produced and secreted by the pituitary gland. It is an important player in the hypothalamic-pituitary-adrenal axis.
• Sequences: SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF
• Molecular Weight: 4541.0658 Da
• Cas No: 12427-33-7
• Formula: C207H308N56O58S
• Endotoxin Level: <0.001 EU per 1 μg of the peptide by the LAL method
• Biological Activity: 80U/ml

Pharmaceutical Information

• Pharmaceutical Application: Corticotropin
• Applications: For use as a diagnostic agent in the screening of patients presumed to have adrenocortical insufficiency.
• Examples of Clinical Use: Adrenocortical insufficiency
• Pharmacodynamics: The product acts through the stimulation of cell surface ACTH receptors, which are primarily located on the adrenocortical cells. The product stimulates the cortex of the adrenal gland and boosts the synthesis of corticosteroids, mainly glucocorticoids but also sex steroids (androgens). The product is also related to the circadian rhythm in many organisms.
• Mechanism of action: As a diagnostic aid (adrenocortical function), corticotropin combines with a specific receptor on the adrenal cell plasma membrane. In patients with normal adrenocortical function, it stimulates the initial reaction involved in the synthesis of adrenal steroids (including cortisol, cortisone, weak androgenic substances, and a limited quantity of aldosterone) from cholesterol by increasing the quantity of cholesterol within the mitochondria. Corticotropin does not significantly increase serum cortisol concentrations in patients with primary adrenocortical insufficiency (Addison's disease). The mechanism of action of corticotropin in the treatment of infantile myoclonic seizures is unknown.
• Affected organisms: Humans and other mammals
• Targets: Target 1. Adrenocorticotropic hormone receptor; Target 2. Corticoliberin