Chymopapain

Specification

• Cat#: THP-0029
• Product Name: Chymopapain
• Description: The product was first isolated in 1941 from the crude latex derived from the fruit of Carica papaya by squeezing the green papaya while on the plant prior to harvest. It is an extracellular plant cysteine proteinase similar to papain in specificity.
• Sequences: MATMSSISKIIFLATCLIIHMGLSSADFYTVGYSQDDLTSIERLIQLFDSWMLKHNKIYESIDEKIYRFEIFRDNLMYIDETNKKNNSYWLGLNGFADLSNDEFKKKYVGFVAEDFTGLEHFDNEDFTYKHVTNYPQSIDWRAKGAVTPVKNQGACGSCWAFSTIATVEGINKIVTGNLLELSEQELVDCDKHSYGCKGGYQTTSLQYVANNGVHTSKVYPYQAKQYKCRATDKPGPKVKITGYKRVPSNCETSFLGALANQPLSVLVEAGGKPFQLYKSGVFDGPCGTKLDHAVTAVGYGTSDGKNYIIIKNSWGPNWGEKGYMRLKRQSGNSQGTCGVYKSSYYPFKGFA
• Species: Carica papaya
• Molecular Weight: 27000.0 Da
• Cas No: 9001-09-6
• Formula: Not Available
• Endotoxin Level: <0.001 EU per 1 μg of the peptide by the LAL method

Pharmaceutical Information

• Pharmaceutical Application: Chymopapain
• Applications: The product is indicated for the development of chemonucleolysis which is used for the digestion of the nucleus pulposus in patients with disc herniation confirmed by myelography. A disc herniation occurs when the outer portion of the spinal disc breaks down and the inner portion (nucleus pulposus) leaks out pressing surrounding nerves and leading to irradiating pain. The chemonucleolysis is a non-surgical treatment that involves the injection of an enzyme to dissolve the nucleus pulposus.
• Examples of Clinical Use: Disc herniation
• Pharmacodynamics: The first studies showed that after intradiscal injection of the product the effect involved the removal of the nucleus pulposus leaving the annulus intact. The clinical reports indicated a spontaneous remission of symptoms after the administration of the product. It is also highly documented an increased urinary excretion of glycosaminoglycans.
• Mechanism of action: Chymopapain is thought to degrade proteoglycan content of the intervertebral disc causing loss of glycosaminoglycan and water. This effect will cause the shrinkage of the disc and a reduction of the pressure on the nerve root.
• Affected organisms: Humans and other mammals
• Targets: Target 1. Bone marrow proteoglycan