0
Inquiry Basket
Quote

Blisibimod, Recombinant Human BAFF/Tnfsf13b inhibitor

Cat# : THP-0309

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0309 Blisibimod, Recombinant Human BAFF/Tnfsf13b inhibitor May 18, 2024 1 vial $2,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0309
Product Name:  Blisibimod, Recombinant Human BAFF/Tnfsf13b inhibitor
Description:  Blisibimod is a novel selective inhibitor of B-cell activating factor (BAFF), binds to both cell membrane-expressed and soluble BAFF.
Sequences:  GCKWDLLIKQWVCDPLGSGSATGGSGSTASSGSGSATHMLPGCKWDLLIKQWVCDPLGGGGGVDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Species:  Human
Molecular Weight:  63.58 kDa
Purity:  >95% by SDS-Page and HPLC analysis
Cas No:  1236126-45-6
Formula:  C2836H4376N756O858S26
Endotoxin Level:  <0.1 EU per 1 μg of the peptide by the LAL method
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.