Cat# : THP-0046
Catalog# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
THP-0046 | Alpha-1-antitrypsin, Alpha-1-proteinase inhibitor | October 07, 2024 | 5mg | $800.00 |
|
Add to Cart Online Order Request a Bulk Order |
Cat#: | THP-0046 |
Product Name: | Alpha-1-antitrypsin, Alpha-1-proteinase inhibitor |
Cas No: | 9041-92-3 |
Description: | Human alpha-1 proteinase inhibitor or alpha-1-antitrypsin, prepared from human plasma via Cohn alcohol fractionation followed by PEG and zinc chloride fractionation. |
Sequences: | EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK |
Species: | Human |
Molecular Weight: | 44324.5 Da |
Source: | human plasma |
Purity: | >99% by SDS-Page and HPLC analysis |
Formula: | C2001H3130N514O601S10 |
Endotoxin: | <0.001 EU per 1 μg by the LAL method |
Biological Activity: | 25 mg / mL |
Storage: | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 2-8 °C for 1 week. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Application: | For chronic augmentation and maintenance therapy in individuals with alpha1-proteinase inhibitor (A1-PI) deficiency and clinical evidence of emphysema. |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2024 Creative BioMart. All Rights Reserved.