Cat# : THP-0046
| Catalog# | Product Name | Availability | Size | Price | Qty |
|---|---|---|---|---|---|
| THP-0046 | Alpha-1-antitrypsin, Alpha-1-proteinase inhibitor | December 30, 2025 | 5mg | $800.00 |
|
| Add to Cart Online Order Request a Bulk Order |
| Cat#: | THP-0046 |
| Product Name: | Alpha-1-antitrypsin, Alpha-1-proteinase inhibitor |
| Cas No: | 9041-92-3 |
| Description: | Human alpha-1 proteinase inhibitor or alpha-1-antitrypsin, prepared from human plasma via Cohn alcohol fractionation followed by PEG and zinc chloride fractionation. |
| Sequences: | EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK |
| Species: | Human |
| Molecular Weight: | 44324.5 Da |
| Source: | human plasma |
| Purity: | >99% by SDS-Page and HPLC analysis |
| Formula: | C2001H3130N514O601S10 |
| Endotoxin: | <0.001 EU per 1 μg by the LAL method |
| Storage: | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 2-8 °C for 1 week. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Application: | For chronic augmentation and maintenance therapy in individuals with alpha1-proteinase inhibitor (A1-PI) deficiency and clinical evidence of emphysema. |
| Concentration: | 25 mg / mL |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2025 Creative BioMart. All Rights Reserved.