Alpha-1-antitrypsin, Alpha-1-proteinase inhibitor

Specification

• Cat#: THP-0046
• Product Name: Alpha-1-antitrypsin, Alpha-1-proteinase inhibitor
• Cas No: 9041-92-3
• Description: Human alpha-1 proteinase inhibitor or alpha-1-antitrypsin, prepared from human plasma via Cohn alcohol fractionation followed by PEG and zinc chloride fractionation.
• Sequences: EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
• Species: Human
• Molecular Weight: 44324.5 Da
• Source: human plasma
• Purity: >99% by SDS-Page and HPLC analysis
• Formula: C2001H3130N514O601S10
• Endotoxin: <0.001 EU per 1 μg by the LAL method
• Storage: Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 2-8 °C for 1 week. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
• Application: For chronic augmentation and maintenance therapy in individuals with alpha1-proteinase inhibitor (A1-PI) deficiency and clinical evidence of emphysema.
• Concentration: 25 mg / mL

Pharmaceutical Information

• Pharmaceutical Application: Alpha-1-proteinase inhibitor
• Targets: Target 1. Neutrophil elastase