0
Inquiry Basket
Quote

ActRIIb: Fc Fusion Protein

Cat# : VAC-0340

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
VAC-0340 ActRIIb: Fc Fusion Protein July 20, 2024 0.5ml $1,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  VAC-0340
Product Name:  ActRIIb: Fc Fusion Protein
Description:  Ramatercept is under investigation in clinical trial NCT00952887 (A Safety, Tolerability, Pharmacokinetic and Pharmacodynamic Study of ACE-031 in Healthy Postmenopausal Women).
Sequences:  GRGEAETRECIYYNANWELERTNQSGLERCIELVKKGCWLDDFNCYDRQECVATEENPQVGGPEVTYEPPPTAPTGGGTHTCPPCPAPELRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVVLTVLHQDWLNGKEYKCKVSNKALPVPIEKREEMTKNQVSLTCLVKGFYPSDIAVEWESNFLYSKLTVDKSRWQQGNVFSCSVMHEALHNEGEQDKRLHCYASWRNSSGTYFCCCEGNFCNERFTHLPEALGGPSVFLFPPKPKDTLMISHNAKTKPREEQYNSTYRVVSTISKAKGQPREPQVYTLPPSGQPENNYKTTPPVLDSDGSFHYTQKSLSLSPGK
Species:  Human
Molecular Weight:  ~77 kDa
Cas No:  1169766-01-1
Formula:  C3418H5188N928O1062S38
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.